UniProtID: C5NS41_PYTOL Gene Symbol: POS-1 DNA Info: EMBL: BAH79720.1 Protein Length: 170 Organism: Pythium oligandrum Taxonomy ID: 41045 Description: Unknown Pubmed: Unknown NCBI RefSeq: Unknown Pfam: ID:PF00964; Description: Elicitin Disease-Host: Numerous hosts Disease-Hostkey: plants Disease: Damping-off; root, stem, and fruit rots DiseaseKey: Damping-off Gene Ontology: ID:0005576; Method: IEA:InterPro; Description: C:extracellular region ID:0006952; Method: IEA:InterPro; Description: P:defense response ID:0009405; Method: IEA:InterPro; Description: P:pathogenesis Protein Sequence: MFSKTLVVLAAVAAVTVNGLTKEECDAAFTGEVGKLTKDALPLVQPCSSDSGFSMVPPKG 60 LPTDDQYVKMCASKNCRALLDVIKNAGLKDCELDFSSLFPGSVPLNVYQLGQGFDAKCDS 120 IGGGSTPTTAPPTGTTPTTAPPTGTTPTTAPPAGTTPGVTPSPTTPKPAC UniProtID: C5NS42_PYTOL Gene Symbol: OLI-D1 DNA Info: EMBL: BAH79721.1 Protein Length: 120 Organism: Pythium oligandrum Taxonomy ID: 41045 Description: Unknown Pubmed: Unknown NCBI RefSeq: Unknown Pfam: ID:PF00964; Description: Elicitin Disease-Host: Numerous hosts Disease-Hostkey: plants Disease: Damping-off; root, stem, and fruit rots DiseaseKey: Damping-off Gene Ontology: ID:0005576; Method: IEA:InterPro; Description: C:extracellular region ID:0006952; Method: IEA:InterPro; Description: P:defense response ID:0009405; Method: IEA:InterPro; Description: P:pathogenesis Protein Sequence: MFTKTLVAFAALAAVSSAATCTDEQFSDSIIKLTPAIGSVSGCTADSGFSMIPPTGLPTN 60 DQYKKMCKSTNCKTLIKEIKDANVADCELDFSKLLPGSVPLNVYVLANNFDFVCAVVGSA 120 UniProtID: C5NS43_PYTOL Gene Symbol: OLI-D2 DNA Info: EMBL: BAH79722.1 Protein Length: 120 Organism: Pythium oligandrum Taxonomy ID: 41045 Description: Unknown Pubmed: Unknown NCBI RefSeq: Unknown Pfam: ID:PF00964; Description: Elicitin Disease-Host: Numerous hosts Disease-Hostkey: plants Disease: Damping-off; root, stem, and fruit rots DiseaseKey: Damping-off Gene Ontology: ID:0005576; Method: IEA:InterPro; Description: C:extracellular region ID:0006952; Method: IEA:InterPro; Description: P:defense response ID:0009405; Method: IEA:InterPro; Description: P:pathogenesis Protein Sequence: MFTKTLVAFAALAAVSSAATCTDEQFSDSIIKLTPAIGSVSGCTADSGFSMIPPTGLPTI 60 EQYKDMCVSGNCKTLIKQIKDANVADCELDFSKLLPGSVPLNVYVLANNFDFVCAAVGSA 120 UniProtID: ELI1_PYTOL Gene Symbol: POD-1 DNA Info: EMBL: BAE95199.1 Protein Length: 170 Organism: Pythium oligandrum Taxonomy ID: 41045 Description: FUNCTION: Induces local and distal defense responses (incompatible hypersensitive reaction) in plants from the solanaceae and cruciferae families. Elicits leaf necrosis and causes the accumulation of pathogenesis-related proteins. Might interact with the lipidic molecules of the plasma membrane (By similarity). SUBCELLULAR LOCATION: Secreted. SIMILARITY: Belongs to the elicitin family. Pubmed: Unknown NCBI RefSeq: Unknown Pfam: ID:PF00964; Description: Elicitin Disease-Host: Numerous hosts Disease-Hostkey: plants Disease: Damping-off; root, stem, and fruit rots DiseaseKey: Damping-off Gene Ontology: ID:0005576; Method: IEA:UniProtKB-SubCell; Description: C:extracellular region ID:0006952; Method: IEA:InterPro; Description: P:defense response ID:0034053; Method: IEA:UniProtKB-KW; Description: P:modulation by symbiont of host defense-related programmed cell death ID:0009405; Method: IEA:InterPro; Description: P:pathogenesis Protein Sequence: MFSKTLVVLAAVAAVTVNGLTKEECDAAFTGEVGKLTKDALPLVQPCSSDSGFSMVPPKG 60 LPTDDQYVKMCASKNCRDLLDVIKKAGLKDCELNFGSVFPGSVPLNVYQLGQGFDAKCAS 120 IGGGSTPTTAPPTSTTPTTAPPTGTTPTTAPPAGTTPGVTPSPTTPKPAC UniProtID: ELI2_PYTOL Gene Symbol: POD-2 DNA Info: EMBL: BAE95200.1 Protein Length: 164 Organism: Pythium oligandrum Taxonomy ID: 41045 Description: FUNCTION: Induces local and distal defense responses (incompatible hypersensitive reaction) in plants from the solanaceae and cruciferae families. Elicits leaf necrosis and causes the accumulation of pathogenesis-related proteins. Might interact with the lipidic molecules of the plasma membrane (By similarity). SUBCELLULAR LOCATION: Secreted. SIMILARITY: Belongs to the elicitin family. Pubmed: Unknown NCBI RefSeq: Unknown Pfam: ID:PF00964; Description: Elicitin Disease-Host: Numerous hosts Disease-Hostkey: plants Disease: Damping-off; root, stem, and fruit rots DiseaseKey: Damping-off Gene Ontology: ID:0005576; Method: IEA:UniProtKB-SubCell; Description: C:extracellular region ID:0006952; Method: IEA:InterPro; Description: P:defense response ID:0034053; Method: IEA:UniProtKB-KW; Description: P:modulation by symbiont of host defense-related programmed cell death ID:0009405; Method: IEA:InterPro; Description: P:pathogenesis Protein Sequence: MFSKTLVVLAAVAAVTVNGLTAKECQDAFTGEVAKLTTGALPLVQPCSSDSGFSMVPPTG 60 LPTDDQYVKMCASKNCKALLEFIKGAGLKDCELNFGSIFPGSVPLNVYQLGQGFDAKCES 120 ISGGGSTPTTAPPSGTTPTTPTTAPPTGTTPGVTPSPTTPKPAC